Identifiers and Description

Gene Model Identifier

SteCoe_32454

Standard Name

Aliases

None

Description

DUF3336 domain protein

Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Homologs

Source Identifier Score
SGD YPL020C 0
Description: ULP1 SGDID:S000005941, Chr XVI from 514178-512313, Geno...
Tetrahymena Thermophila TTHERM_00548040 1.0377033238158346e-53
Description: Multifunctional lipase/hydrolase/phospholipase
Oxytricha Trifallax Contig8909.0.g2 1.368539471173853e-44
Description: Domain of unknown function (DUF3336)
Saccharomyces Cerevisiae YKR089C 1.9792598779469045e-32
Description: Multifunctional lipase/hydrolase/phospholipase; triacylglycerol lipase, steryl ester hydrolase, and Ca2+-independent phospholipase A2; catalyzes acyl-CoA dependent acylation of LPA to PA; required with Tgl3p for timely bud formation; phosphorylated and activated by Cdc28p; TGL4 has a paralog, TGL5, that arose from the whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32454(CDS)
ATGCTAGCTAAGGTTAAAGGTTGGCTGACTATAACATGGCAAGACAATATCGCTGAAGAA
GCATTTGAACTTTCTGAAGCTGTTCAAGAGATGGGAGAAAAGCTTTATTCAAAGATACAA
GAATATTTTTGGGACGTAGGCGAAATCATGTATTACAAAAAGAAGATGGATCGAGCTAAA
GACTGGAAAACCTGGAAAAAAGCGGCTATTGAAGTAGATAAACTTGAAGGAAAAGATGAT
TGGAGATACAGGGAACAAAGCCCAATGTATGATTACAAATTATTAAGAGGAAGGCTAAAA
CTAATGAGAAGTTTACAACAATCAGATGAAGTTGAAGCACTAGTCCATCATTTAAGATCT
GGCCTTTTTAGAGGTCTTGGGGGAAATCTCCATCCTGAACTCTATAACAAATGCTTGGTA
GGCACAAAATCTCTAATCATTGAGTATCAGAAAGAAGTAAAAAAAGCATTAAATTATATT
TTAAACTCGCAGACCTTTCCAATGAAAGATAAAGTTACTTTTTTCACAGAATCACGCTAT
GCATATGGTAGAACTGCTTTATTATTAAGTGGAGGTGGTGGCCTTGGACTTTATCATTTA
GGTGTTGTGAAAACTTTATATGAAAAAAACTTGTTGCCGAAAATTATCGCAGGAACTTCA
GCTGGATCGATTGTTGCAGCTTTTATTTGCACAACTGTATGGGAAGATATCCCACGTTGG
TTTGAACCAGGGAAAATTCTCTATGGACCTGACTCAGGACTTGAAAGTGGCTCATTGTTT
AAAAAAATAAGAAAATTCTTAGAAAGGGGTTATATGCTGGATATAAGCTTATTTGAAAAG
TTTTTAAGAAACAATCTTGGTGAAATTACTTTTGAAGAAGCTTATTTGAAATCAGGTTTA
ATATTGAATATAACAGTAAGTGAGACTAATGATTTTAATGACTTTAGGCTGATGAATTAT
CTTACTGCACCACATGTGCTTATTTGGAGTGCAGTTCTTGCTTCGTGTGCTATTCCATTT
GTTTTCGAAGCAGTTGAGCTAAAGTGTAAAAATCATAAAGGTGAGACTGTCCTTTACCAC
CCTTCCGGGCTAAAATTCATAGACGGGTCTATTAAAGCAGATTTACCAATGCAAAGACTA
TCTGAGCTTTTCAATGTAAACGCATTTATAGTATCTCAAACTAATCCTTGGGTTATTCCT
CTATTATCCCCAGATGATGGAGGAGGTTTATGGGGCGACTCATTCCAATTTAAACTATTA
AGATTAGTAAAAAGACTTTGTTTAATGGAGTTTAGATACANACTTTTCAATGTAAACGCA
TTTATAGTATCTCAAACTAATCCTTGGGTTATTCCTCTATTATCCCCAGATGATGGAGGA
GGTTTATGGGGTGACTCATTCCAATTTAAACTATTAAGATTAGTAAAAAGACTTTGTTTA
ATGGAGTTTAGATACAGAGTCCAACAACTAAATCTTATTGGCATGTGCAATTTCTTGTCT
TGGGTTTTAGGGATTTTTACACAAGAGTACAGAGGACATGTTACTATTTGGCCTATCCCT
CATATTAGAGATTATGTTAATATTATATCAAATCCTACTCAAGATGATATTCAGCGCTGC
ATTAAAAAAGGCCAAAACAGAACTTTCCCAAAAATCGGCATGCTAAAGTCCATCATGGCT
ATTGAGGCTGACTTTGATTTTTGCTGTTCAGAACTTAAAAGTAGATTAAGCAACCGTGAT
ATGTCTCCAAAAGAATCTATTAATGAAGAAATAGATGATAATAATACTGTAGCTGTGGGT
TCTTTCCACAAATAG


>SteCoe_32454(Protein)
MLAKVKGWLTITWQDNIAEEAFELSEAVQEMGEKLYSKIQEYFWDVGEIMYYKKKMDRAK
DWKTWKKAAIEVDKLEGKDDWRYREQSPMYDYKLLRGRLKLMRSLQQSDEVEALVHHLRS
GLFRGLGGNLHPELYNKCLVGTKSLIIEYQKEVKKALNYILNSQTFPMKDKVTFFTESRY
AYGRTALLLSGGGGLGLYHLGVVKTLYEKNLLPKIIAGTSAGSIVAAFICTTVWEDIPRW
FEPGKILYGPDSGLESGSLFKKIRKFLERGYMLDISLFEKFLRNNLGEITFEEAYLKSGL
ILNITVSETNDFNDFRLMNYLTAPHVLIWSAVLASCAIPFVFEAVELKCKNHKGETVLYH
PSGLKFIDGSIKADLPMQRLSELFNVNAFIVSQTNPWVIPLLSPDDGGGLWGDSFQFKLL
RLVKRLCLMEFRYXLFNVNAFIVSQTNPWVIPLLSPDDGGGLWGDSFQFKLLRLVKRLCL
MEFRYRVQQLNLIGMCNFLSWVLGIFTQEYRGHVTIWPIPHIRDYVNIISNPTQDDIQRC
IKKGQNRTFPKIGMLKSIMAIEADFDFCCSELKSRLSNRDMSPKESINEEIDDNNTVAVG
SFHK